PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00253.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Nin-like
Protein Properties Length: 800aa    MW: 89086.8 Da    PI: 6.3346
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00253.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK93.81.3e-29531582152
                   RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                              aek+i+l++l++yF++++kdAAk++gvc+T+LKriCRq+GI+RWP+Rkik++
  Rsa1.0_00253.1_g00001.1 531 AEKNITLDVLRQYFAGSLKDAAKSIGVCPTTLKRICRQHGIQRWPSRKIKKV 582
                              589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.2519602IPR003035RWP-RK domain
PfamPF020421.2E-25534582IPR003035RWP-RK domain
SuperFamilySSF542773.68E-22692788No hitNo description
SMARTSM006661.6E-24702785IPR000270PB1 domain
PROSITE profilePS5174527.921702785IPR000270PB1 domain
CDDcd064079.59E-37703779No hitNo description
PfamPF005649.4E-18703783IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2402.1E-19703782No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 800 aa     Download sequence    Send to blast
MDPAMDSSFM DGLLLDGCWL ETTTTDASEF PNFSPSTSIS PFDPSSFMWS PTQDNTTAAP  60
ISSSTLSQVY YGQGLEDLSS LNRRWWIGPS GGGLGSTVME RLVQAVKHIK DFSSDRGDSL  120
IQLWVPVDRG GKRVLTTKEQ PFSHDPMSQR LAHYREISEK YQFSAEQEDS SSSSKDLVGL  180
PGRVFLGQVP EWTPDVRFFK NEEYPRVQHA QDCDVRGTLA IPVFEQGSKT CLGVIEVVMT  240
TQMVKLSPEL DSICRALQAV DLRSTEVPIS PSLKGPDFTY QAALPEIRNL LRCACETHKL  300
PLAQTWMSCL KQSKTGCRHN DHNYIHCVST IDDACYVGDP TVREFHEACS EHHLLKGQGV  360
VGEAFLTNGP CFSSDVSSYK KSEYPLSHHA TMFGLHGTVA IRLRCIHTGS ADFVLEFFLP  420
KDCRDIEEQR RMLNALSTIM AHVPRSLRTV TDKELEEEGD STVETVPKTE STCEVHESNS  480
NNPQRVGGTS EMGELGFDYG KGVSVNENST FSSGGGGGGS SRVTERKKTK AEKNITLDVL  540
RQYFAGSLKD AAKSIGVCPT TLKRICRQHG IQRWPSRKIK KVGHSLQKIQ RVIDSVQGVS  600
GHHLPIGSFY ANFPNLASSQ EASSSQQQQS KQTTFLPSSQ SQPAKSPGSS CSHTSSCSSE  660
TQVNKEEPTN KAREDAMTLS RSFKETQTTQ LSPSTSSQDD DFLRIKVSYE EEKIRFRMRN  720
SRRLKDLLWE IAKRFSIEDV SRYDLKYLDE DNEWVLLRCD DDVEECVDVC RSFPGQTIKL  780
LLQLSSQHLQ ERSSVSGSLS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013702515.10.0PREDICTED: protein NLP5-like isoform X1
SwissprotQ9SFW80.0NLP5_ARATH; Protein NLP5
TrEMBLA0A078DEG40.0A0A078DEG4_BRANA; BnaA07g32630D protein
STRINGBra015758.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34612663
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76350.10.0Nin-like family protein